Lineage for d1vlhf_ (1vlh F:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 579981Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 579982Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 580134Family c.26.1.3: Adenylyltransferase [52397] (5 proteins)
  6. 580220Protein Phosphopantetheine adenylyltransferase [52398] (5 species)
  7. 580234Species Thermotoga maritima [TaxId:243274] [110491] (1 PDB entry)
  8. 580240Domain d1vlhf_: 1vlh F: [108829]
    Structural genomics target
    complexed with mpd, pns

Details for d1vlhf_

PDB Entry: 1vlh (more details), 2.2 Å

PDB Description: Crystal structure of Phosphopantetheine adenylyltransferase (TM0741) from Thermotoga maritima at 2.20 A resolution

SCOP Domain Sequences for d1vlhf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlhf_ c.26.1.3 (F:) Phosphopantetheine adenylyltransferase {Thermotoga maritima}
mkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftleerkklieevlsdl
dgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankklysdletvfliase
kfsfissslvkevalyggdvtewvppevaralneklk

SCOP Domain Coordinates for d1vlhf_:

Click to download the PDB-style file with coordinates for d1vlhf_.
(The format of our PDB-style files is described here.)

Timeline for d1vlhf_: