![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) ![]() |
![]() | Family c.26.1.3: Adenylyltransferase [52397] (5 proteins) |
![]() | Protein Phosphopantetheine adenylyltransferase [52398] (5 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [110491] (1 PDB entry) |
![]() | Domain d1vlhf_: 1vlh F: [108829] Structural genomics target |
PDB Entry: 1vlh (more details), 2.2 Å
SCOP Domain Sequences for d1vlhf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlhf_ c.26.1.3 (F:) Phosphopantetheine adenylyltransferase {Thermotoga maritima} mkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftleerkklieevlsdl dgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankklysdletvfliase kfsfissslvkevalyggdvtewvppevaralneklk
Timeline for d1vlhf_: