Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Phosphopantetheine adenylyltransferase [52398] (6 species) |
Species Thermotoga maritima [TaxId:2336] [110491] (1 PDB entry) Uniprot Q9WZK0 |
Domain d1vlhe_: 1vlh E: [108828] Structural genomics target complexed with mpd, pns |
PDB Entry: 1vlh (more details), 2.2 Å
SCOPe Domain Sequences for d1vlhe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlhe_ c.26.1.3 (E:) Phosphopantetheine adenylyltransferase {Thermotoga maritima [TaxId: 2336]} mkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftleerkklieevlsdl dgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankklysdletvfliase kfsfissslvkevalyggdvtewvppevaralneklk
Timeline for d1vlhe_: