Lineage for d1vlha_ (1vlh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860491Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2860561Species Thermotoga maritima [TaxId:2336] [110491] (1 PDB entry)
    Uniprot Q9WZK0
  8. 2860562Domain d1vlha_: 1vlh A: [108824]
    Structural genomics target
    complexed with mpd, pns

Details for d1vlha_

PDB Entry: 1vlh (more details), 2.2 Å

PDB Description: Crystal structure of Phosphopantetheine adenylyltransferase (TM0741) from Thermotoga maritima at 2.20 A resolution
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d1vlha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlha_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermotoga maritima [TaxId: 2336]}
mkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftleerkklieevlsdl
dgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankklysdletvfliase
kfsfissslvkevalyggdvtewvppevaralneklk

SCOPe Domain Coordinates for d1vlha_:

Click to download the PDB-style file with coordinates for d1vlha_.
(The format of our PDB-style files is described here.)

Timeline for d1vlha_: