Class a: All alpha proteins [46456] (226 folds) |
Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (3 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (7 proteins) |
Protein Non-hem ferritin [63524] (3 species) |
Species Thermotoga maritima [TaxId:243274] [109783] (1 PDB entry) |
Domain d1vlgg_: 1vlg G: [108822] |
PDB Entry: 1vlg (more details), 2 Å
SCOP Domain Sequences for d1vlgg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlgg_ a.25.1.1 (G:) Non-hem ferritin {Thermotoga maritima} mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
Timeline for d1vlgg_: