Lineage for d1vlgg_ (1vlg G:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. Protein Non-hem ferritin [63524] (7 species)
  7. Species Thermotoga maritima [TaxId:2336] [109783] (1 PDB entry)
    Uniprot Q9X0L2
  8. Domain d1vlgg_: 1vlg G: [108822]
    Structural genomics target
    complexed with fe, gol, so4

Details for d1vlgg_

PDB Entry: 1vlg (more details), 2 Å

PDB Description: crystal structure of ferritin (tm1128) from thermotoga maritima at 2.00 a resolution
PDB Compounds: (G:) Ferritin

SCOPe Domain Sequences for d1vlgg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlgg_ a.25.1.1 (G:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]}
mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre

SCOPe Domain Coordinates for d1vlgg_ are not available.

Timeline for d1vlgg_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vlga_, d1vlgb_, d1vlgc_, d1vlgd_, d1vlge_, d1vlgf_, d1vlgh_