Lineage for d1vlge_ (1vlg E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702136Protein Non-hem ferritin [63524] (7 species)
  7. 2702229Species Thermotoga maritima [TaxId:2336] [109783] (5 PDB entries)
    Uniprot Q9X0L2
  8. 2702234Domain d1vlge_: 1vlg E: [108820]
    Structural genomics target
    complexed with fe, gol, so4

Details for d1vlge_

PDB Entry: 1vlg (more details), 2 Å

PDB Description: crystal structure of ferritin (tm1128) from thermotoga maritima at 2.00 a resolution
PDB Compounds: (E:) Ferritin

SCOPe Domain Sequences for d1vlge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlge_ a.25.1.1 (E:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]}
mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre

SCOPe Domain Coordinates for d1vlge_:

Click to download the PDB-style file with coordinates for d1vlge_.
(The format of our PDB-style files is described here.)

Timeline for d1vlge_: