SCOP 1.71: Domain d1vlfx2: 1vlf X:1-195

Lineage for d1vlfx2 (1vlf X:1-195)

Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families)
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (9 proteins)
members of this "family" may be more closely related to other ferredoxins than to each other
Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)
Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)

Domain d1vlfx2: 1vlf X:1-195 [108815]
Other proteins in same PDB: d1vlfm1, d1vlfm2, d1vlfn1, d1vlfo1, d1vlfo2, d1vlfp1, d1vlfq1, d1vlfq2, d1vlfr1, d1vlfs1, d1vlfs2, d1vlft1, d1vlfu1, d1vlfu2, d1vlfv1, d1vlfw1, d1vlfw2, d1vlfx1
complexed with 4mo, btt, ca, fs4, mgd

Details for d1vlfx2

PDB Entry: 1vlf (more details), 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene

SCOP Domain Sequences for d1vlfx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlfx2 d.58.1.5 (X:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

SCOP Domain Coordinates for d1vlfx2:

Click to download the PDB-style file with coordinates for d1vlfx2.
(The format of our PDB-style files is described here.)

Timeline for d1vlfx2: