Lineage for d1vlfw1 (1vlf W:729-875)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467143Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 467166Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 467190Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins)
    molybdopterine enzyme
  6. 467244Protein Transhydroxylase alpha subunit, AthL [110250] (1 species)
  7. 467245Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries)
  8. 467257Domain d1vlfw1: 1vlf W:729-875 [108812]
    Other proteins in same PDB: d1vlfm2, d1vlfn1, d1vlfn2, d1vlfo2, d1vlfp1, d1vlfp2, d1vlfq2, d1vlfr1, d1vlfr2, d1vlfs2, d1vlft1, d1vlft2, d1vlfu2, d1vlfv1, d1vlfv2, d1vlfw2, d1vlfx1, d1vlfx2

Details for d1vlfw1

PDB Entry: 1vlf (more details), 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene

SCOP Domain Sequences for d1vlfw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlfw1 b.52.2.2 (W:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici}
kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd
lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi
skyacgmanntalveiekwdgdkyeiy

SCOP Domain Coordinates for d1vlfw1:

Click to download the PDB-style file with coordinates for d1vlfw1.
(The format of our PDB-style files is described here.)

Timeline for d1vlfw1: