Lineage for d1vlfv2 (1vlf V:1-195)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949395Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)
  7. 2949396Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)
    Uniprot P80564
  8. 2949401Domain d1vlfv2: 1vlf V:1-195 [108811]
    Other proteins in same PDB: d1vlfm1, d1vlfm2, d1vlfn1, d1vlfo1, d1vlfo2, d1vlfp1, d1vlfq1, d1vlfq2, d1vlfr1, d1vlfs1, d1vlfs2, d1vlft1, d1vlfu1, d1vlfu2, d1vlfv1, d1vlfw1, d1vlfw2, d1vlfx1
    complexed with 4mo, btt, ca, mgd, sf4
    complexed with 4mo, btt, ca, mgd, sf4

Details for d1vlfv2

PDB Entry: 1vlf (more details), 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene
PDB Compounds: (V:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1vlfv2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlfv2 d.58.1.5 (V:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

SCOPe Domain Coordinates for d1vlfv2:

Click to download the PDB-style file with coordinates for d1vlfv2.
(The format of our PDB-style files is described here.)

Timeline for d1vlfv2: