SCOP 1.73: Domain d1vlfv1: 1vlf V:196-274

Lineage for d1vlfv1 (1vlf V:196-274)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.5: Cna protein B-type domain [49478] (1 family)

5. Family b.3.5.1: Cna protein B-type domain [49479] (2 proteins)
   Pfam PF05738

6. Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
   the penultimate strand is in the other beta-sheet than in the Cna repeats

7. Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)

8. Domain d1vlfv1: 1vlf V:196-274 [108810]
   Other proteins in same PDB: d1vlfm1, d1vlfm2, d1vlfn2, d1vlfo1, d1vlfo2, d1vlfp2, d1vlfq1, d1vlfq2, d1vlfr2, d1vlfs1, d1vlfs2, d1vlft2, d1vlfu1, d1vlfu2, d1vlfv2, d1vlfw1, d1vlfw2, d1vlfx2

Details for d1vlfv1

PDB Entry: 1vlf, 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene

PDB Compounds: (V:) Pyrogallol hydroxytransferase small subunit

SCOP Domain Sequences for d1vlfv1:

Sequence; same for both SEQRES and ATOM records:

>d1vlfv1 b.3.5.1 (V:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

Timeline for d1vlfv1:

• d1vlfv1 first appeared in SCOP 1.69
  
• d1vlfv1 appears in SCOP 1.71
  
• d1vlfv1 appears in SCOP 1.75
  
• d1vlfv1 appears in the current release, SCOPe 2.08