![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) ![]() |
![]() | Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins) Pfam PF05738 |
![]() | Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species) the penultimate strand is in the other beta-sheet than in the Cna repeats |
![]() | Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries) Uniprot P80564 |
![]() | Domain d1vlfv1: 1vlf V:196-274 [108810] Other proteins in same PDB: d1vlfm1, d1vlfm2, d1vlfn2, d1vlfo1, d1vlfo2, d1vlfp2, d1vlfq1, d1vlfq2, d1vlfr2, d1vlfs1, d1vlfs2, d1vlft2, d1vlfu1, d1vlfu2, d1vlfv2, d1vlfw1, d1vlfw2, d1vlfx2 complexed with 4mo, btt, ca, mgd, sf4 complexed with 4mo, btt, ca, mgd, sf4 |
PDB Entry: 1vlf (more details), 2 Å
SCOPe Domain Sequences for d1vlfv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlfv1 b.3.5.1 (V:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]} knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks ysdtvviddksvdlgfikl
Timeline for d1vlfv1: