Lineage for d1vlft2 (1vlf T:1-195)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 503918Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 504015Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (9 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 504071Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)
  7. 504072Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)
  8. 504082Domain d1vlft2: 1vlf T:1-195 [108807]
    Other proteins in same PDB: d1vlfm1, d1vlfm2, d1vlfn1, d1vlfo1, d1vlfo2, d1vlfp1, d1vlfq1, d1vlfq2, d1vlfr1, d1vlfs1, d1vlfs2, d1vlft1, d1vlfu1, d1vlfu2, d1vlfv1, d1vlfw1, d1vlfw2, d1vlfx1

Details for d1vlft2

PDB Entry: 1vlf (more details), 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene

SCOP Domain Sequences for d1vlft2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlft2 d.58.1.5 (T:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

SCOP Domain Coordinates for d1vlft2:

Click to download the PDB-style file with coordinates for d1vlft2.
(The format of our PDB-style files is described here.)

Timeline for d1vlft2: