Lineage for d1vlfo2 (1vlf O:1-728)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140604Protein Transhydroxylase alpha subunit, AthL [110729] (1 species)
  7. 2140605Species Pelobacter acidigallici [TaxId:35816] [110730] (6 PDB entries)
    Uniprot P80563
  8. 2140607Domain d1vlfo2: 1vlf O:1-728 [108797]
    Other proteins in same PDB: d1vlfm1, d1vlfn1, d1vlfn2, d1vlfo1, d1vlfp1, d1vlfp2, d1vlfq1, d1vlfr1, d1vlfr2, d1vlfs1, d1vlft1, d1vlft2, d1vlfu1, d1vlfv1, d1vlfv2, d1vlfw1, d1vlfx1, d1vlfx2
    complexed with 4mo, btt, ca, mgd, sf4
    complexed with 4mo, btt, ca, mgd, sf4

Details for d1vlfo2

PDB Entry: 1vlf (more details), 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene
PDB Compounds: (O:) Pyrogallol hydroxytransferase large subunit

SCOPe Domain Sequences for d1vlfo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlfo2 c.81.1.1 (O:1-728) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]}
mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
qkhsplav

SCOPe Domain Coordinates for d1vlfo2:

Click to download the PDB-style file with coordinates for d1vlfo2.
(The format of our PDB-style files is described here.)

Timeline for d1vlfo2: