Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.58: Ferredoxin-like [54861] (49 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (9 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species) |
Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries) |
Domain d1vlfn2: 1vlf N:1-195 [108795] Other proteins in same PDB: d1vlfm1, d1vlfm2, d1vlfn1, d1vlfo1, d1vlfo2, d1vlfp1, d1vlfq1, d1vlfq2, d1vlfr1, d1vlfs1, d1vlfs2, d1vlft1, d1vlfu1, d1vlfu2, d1vlfv1, d1vlfw1, d1vlfw2, d1vlfx1 |
PDB Entry: 1vlf (more details), 2 Å
SCOP Domain Sequences for d1vlfn2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici} meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel gtkprvyyknlyrfe
Timeline for d1vlfn2: