SCOP 1.69: Domain d1vlfn2: 1vlf N:1-195

Lineage for d1vlfn2 (1vlf N:1-195)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (9 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)

7. Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)

8. Domain d1vlfn2: 1vlf N:1-195 [108795]
   Other proteins in same PDB: d1vlfm1, d1vlfm2, d1vlfn1, d1vlfo1, d1vlfo2, d1vlfp1, d1vlfq1, d1vlfq2, d1vlfr1, d1vlfs1, d1vlfs2, d1vlft1, d1vlfu1, d1vlfu2, d1vlfv1, d1vlfw1, d1vlfw2, d1vlfx1

Details for d1vlfn2

PDB Entry: 1vlf, 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene

SCOP Domain Sequences for d1vlfn2:

Sequence; same for both SEQRES and ATOM records:

>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

Timeline for d1vlfn2:

• d1vlfn2 is new in SCOP 1.69
  
• d1vlfn2 appears in SCOP 1.71
  
• d1vlfn2 appears in the current release, SCOPe 2.08