Lineage for d1vlfn1 (1vlf N:196-274)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457077Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 457366Superfamily b.3.5: Cna protein B-type domain (Pfam 05738) [49478] (1 family) (S)
  5. 457367Family b.3.5.1: Cna protein B-type domain (Pfam 05738) [49479] (2 proteins)
  6. 457378Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
    the penultimate strand is in the other beta-sheet than in the Cna repeats
  7. 457379Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)
  8. 457386Domain d1vlfn1: 1vlf N:196-274 [108794]
    Other proteins in same PDB: d1vlfm1, d1vlfm2, d1vlfn2, d1vlfo1, d1vlfo2, d1vlfp2, d1vlfq1, d1vlfq2, d1vlfr2, d1vlfs1, d1vlfs2, d1vlft2, d1vlfu1, d1vlfu2, d1vlfv2, d1vlfw1, d1vlfw2, d1vlfx2

Details for d1vlfn1

PDB Entry: 1vlf (more details), 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene

SCOP Domain Sequences for d1vlfn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlfn1 b.3.5.1 (N:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

SCOP Domain Coordinates for d1vlfn1:

Click to download the PDB-style file with coordinates for d1vlfn1.
(The format of our PDB-style files is described here.)

Timeline for d1vlfn1: