SCOP 1.73: Domain d1vlew1: 1vle W:729-875

Lineage for d1vlew1 (1vle W:729-875)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Transhydroxylase alpha subunit, AthL [110250] (1 species)

7. Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries)

8. Domain d1vlew1: 1vle W:729-875 [108788]
   Other proteins in same PDB: d1vlem2, d1vlen1, d1vlen2, d1vleo2, d1vlep1, d1vlep2, d1vleq2, d1vler1, d1vler2, d1vles2, d1vlet1, d1vlet2, d1vleu2, d1vlev1, d1vlev2, d1vlew2, d1vlex1, d1vlex2
   complexed with 4mo, ca, fs4, mgd, pyg

Details for d1vlew1

PDB Entry: 1vle, 2.2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol

PDB Compounds: (W:) Pyrogallol hydroxytransferase large subunit

SCOP Domain Sequences for d1vlew1:

Sequence; same for both SEQRES and ATOM records:

>d1vlew1 b.52.2.2 (W:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]}
kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd
lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi
skyacgmanntalveiekwdgdkyeiy

Timeline for d1vlew1:

• d1vlew1 first appeared in SCOP 1.69
  
• d1vlew1 appears in SCOP 1.71
  
• d1vlew1 appears in SCOP 1.75
  
• d1vlew1 appears in the current release, SCOPe 2.08