![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species) |
![]() | Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries) Uniprot P80564 |
![]() | Domain d1vlev2: 1vle V:1-195 [108787] Other proteins in same PDB: d1vlem1, d1vlem2, d1vlen1, d1vleo1, d1vleo2, d1vlep1, d1vleq1, d1vleq2, d1vler1, d1vles1, d1vles2, d1vlet1, d1vleu1, d1vleu2, d1vlev1, d1vlew1, d1vlew2, d1vlex1 complexed with 4mo, ca, mgd, pyg, sf4 complexed with 4mo, ca, mgd, pyg, sf4 |
PDB Entry: 1vle (more details), 2.2 Å
SCOPe Domain Sequences for d1vlev2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlev2 d.58.1.5 (V:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel gtkprvyyknlyrfe
Timeline for d1vlev2: