Lineage for d1vlev1 (1vle V:196-274)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2769819Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) (S)
  5. 2769820Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins)
    Pfam PF05738
  6. 2769840Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
    the penultimate strand is in the other beta-sheet than in the Cna repeats
  7. 2769841Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)
    Uniprot P80564
  8. 2769864Domain d1vlev1: 1vle V:196-274 [108786]
    Other proteins in same PDB: d1vlem1, d1vlem2, d1vlen2, d1vleo1, d1vleo2, d1vlep2, d1vleq1, d1vleq2, d1vler2, d1vles1, d1vles2, d1vlet2, d1vleu1, d1vleu2, d1vlev2, d1vlew1, d1vlew2, d1vlex2
    complexed with 4mo, ca, mgd, pyg, sf4
    complexed with 4mo, ca, mgd, pyg, sf4

Details for d1vlev1

PDB Entry: 1vle (more details), 2.2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol
PDB Compounds: (V:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1vlev1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlev1 b.3.5.1 (V:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

SCOPe Domain Coordinates for d1vlev1:

Click to download the PDB-style file with coordinates for d1vlev1.
(The format of our PDB-style files is described here.)

Timeline for d1vlev1: