SCOPe 2.06: Domain d1vlet1: 1vle T:196-274

Lineage for d1vlet1 (1vle T:196-274)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.5: Cna protein B-type domain [49478] (2 families)

5. Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins)
   Pfam PF05738

6. Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
   the penultimate strand is in the other beta-sheet than in the Cna repeats

7. Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)
   Uniprot P80564

8. Domain d1vlet1: 1vle T:196-274 [108782]
   Other proteins in same PDB: d1vlem1, d1vlem2, d1vlen2, d1vleo1, d1vleo2, d1vlep2, d1vleq1, d1vleq2, d1vler2, d1vles1, d1vles2, d1vlet2, d1vleu1, d1vleu2, d1vlev2, d1vlew1, d1vlew2, d1vlex2
   complexed with 4mo, ca, mgd, pyg, sf4
   complexed with 4mo, ca, mgd, pyg, sf4

Details for d1vlet1

PDB Entry: 1vle, 2.2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol

PDB Compounds: (T:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1vlet1:

Sequence; same for both SEQRES and ATOM records:

>d1vlet1 b.3.5.1 (T:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

Timeline for d1vlet1:

• d1vlet1 first appeared in SCOP 1.69
  
• d1vlet1 appears in SCOPe 2.05
  
• d1vlet1 appears in SCOPe 2.07
  
• d1vlet1 appears in the current release, SCOPe 2.08