![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.5: Cna protein B-type domain [49478] (1 family) ![]() |
![]() | Family b.3.5.1: Cna protein B-type domain [49479] (2 proteins) Pfam 05738 |
![]() | Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species) the penultimate strand is in the other beta-sheet than in the Cna repeats |
![]() | Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries) |
![]() | Domain d1vlet1: 1vle T:196-274 [108782] Other proteins in same PDB: d1vlem1, d1vlem2, d1vlen2, d1vleo1, d1vleo2, d1vlep2, d1vleq1, d1vleq2, d1vler2, d1vles1, d1vles2, d1vlet2, d1vleu1, d1vleu2, d1vlev2, d1vlew1, d1vlew2, d1vlex2 |
PDB Entry: 1vle (more details), 2.2 Å
SCOP Domain Sequences for d1vlet1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlet1 b.3.5.1 (T:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici} knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks ysdtvviddksvdlgfikl
Timeline for d1vlet1: