Lineage for d1vleo1 (1vle O:729-875)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467143Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 467166Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 467190Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins)
    molybdopterine enzyme
  6. 467244Protein Transhydroxylase alpha subunit, AthL [110250] (1 species)
  7. 467245Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries)
  8. 467265Domain d1vleo1: 1vle O:729-875 [108772]
    Other proteins in same PDB: d1vlem2, d1vlen1, d1vlen2, d1vleo2, d1vlep1, d1vlep2, d1vleq2, d1vler1, d1vler2, d1vles2, d1vlet1, d1vlet2, d1vleu2, d1vlev1, d1vlev2, d1vlew2, d1vlex1, d1vlex2

Details for d1vleo1

PDB Entry: 1vle (more details), 2.2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol

SCOP Domain Sequences for d1vleo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vleo1 b.52.2.2 (O:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici}
kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd
lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi
skyacgmanntalveiekwdgdkyeiy

SCOP Domain Coordinates for d1vleo1:

Click to download the PDB-style file with coordinates for d1vleo1.
(The format of our PDB-style files is described here.)

Timeline for d1vleo1: