Lineage for d1vlen2 (1vle N:1-195)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 503918Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 504015Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (9 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 504071Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)
  7. 504072Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)
  8. 504091Domain d1vlen2: 1vle N:1-195 [108771]
    Other proteins in same PDB: d1vlem1, d1vlem2, d1vlen1, d1vleo1, d1vleo2, d1vlep1, d1vleq1, d1vleq2, d1vler1, d1vles1, d1vles2, d1vlet1, d1vleu1, d1vleu2, d1vlev1, d1vlew1, d1vlew2, d1vlex1

Details for d1vlen2

PDB Entry: 1vle (more details), 2.2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol

SCOP Domain Sequences for d1vlen2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlen2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

SCOP Domain Coordinates for d1vlen2:

Click to download the PDB-style file with coordinates for d1vlen2.
(The format of our PDB-style files is described here.)

Timeline for d1vlen2: