Lineage for d1vlen2 (1vle N:1-195)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949395Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)
  7. 2949396Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)
    Uniprot P80564
  8. 2949415Domain d1vlen2: 1vle N:1-195 [108771]
    Other proteins in same PDB: d1vlem1, d1vlem2, d1vlen1, d1vleo1, d1vleo2, d1vlep1, d1vleq1, d1vleq2, d1vler1, d1vles1, d1vles2, d1vlet1, d1vleu1, d1vleu2, d1vlev1, d1vlew1, d1vlew2, d1vlex1
    complexed with 4mo, ca, mgd, pyg, sf4
    complexed with 4mo, ca, mgd, pyg, sf4

Details for d1vlen2

PDB Entry: 1vle (more details), 2.2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol
PDB Compounds: (N:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1vlen2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlen2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

SCOPe Domain Coordinates for d1vlen2:

Click to download the PDB-style file with coordinates for d1vlen2.
(The format of our PDB-style files is described here.)

Timeline for d1vlen2: