SCOP 1.69: Domain d1vldv2: 1vld V:1-195

Lineage for d1vldv2 (1vld V:1-195)

Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families)
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (9 proteins)
members of this "family" may be more closely related to other ferredoxins than to each other
Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)
Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)

Domain d1vldv2: 1vld V:1-195 [108763]
Other proteins in same PDB: d1vldm1, d1vldm2, d1vldn1, d1vldo1, d1vldo2, d1vldp1, d1vldq1, d1vldq2, d1vldr1, d1vlds1, d1vlds2, d1vldt1, d1vldu1, d1vldu2, d1vldv1, d1vldw1, d1vldw2, d1vldx1

Details for d1vldv2

PDB Entry: 1vld (more details), 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici

SCOP Domain Sequences for d1vldv2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vldv2 d.58.1.5 (V:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

SCOP Domain Coordinates for d1vldv2:

Click to download the PDB-style file with coordinates for d1vldv2.
(The format of our PDB-style files is described here.)

Timeline for d1vldv2: