Lineage for d1vldp1 (1vld P:196-274)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552997Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 553292Superfamily b.3.5: Cna protein B-type domain [49478] (1 family) (S)
  5. 553293Family b.3.5.1: Cna protein B-type domain [49479] (2 proteins)
    Pfam 05738
  6. 553304Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
    the penultimate strand is in the other beta-sheet than in the Cna repeats
  7. 553305Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)
  8. 553337Domain d1vldp1: 1vld P:196-274 [108750]
    Other proteins in same PDB: d1vldm1, d1vldm2, d1vldn2, d1vldo1, d1vldo2, d1vldp2, d1vldq1, d1vldq2, d1vldr2, d1vlds1, d1vlds2, d1vldt2, d1vldu1, d1vldu2, d1vldv2, d1vldw1, d1vldw2, d1vldx2

Details for d1vldp1

PDB Entry: 1vld (more details), 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici
PDB Compounds: (P:)

SCOP Domain Sequences for d1vldp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vldp1 b.3.5.1 (P:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

SCOP Domain Coordinates for d1vldp1:

Click to download the PDB-style file with coordinates for d1vldp1.
(The format of our PDB-style files is described here.)

Timeline for d1vldp1: