Lineage for d1vlba4 (1vlb A:311-907)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511393Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 511394Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
  5. 511395Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (5 proteins)
  6. 511396Protein Aldehyde oxidoreductase [56005] (2 species)
  7. 511399Species Desulfovibrio gigas [TaxId:879] [56006] (2 PDB entries)
  8. 511400Domain d1vlba4: 1vlb A:311-907 [108742]
    Other proteins in same PDB: d1vlba1, d1vlba2, d1vlba3

Details for d1vlba4

PDB Entry: 1vlb (more details), 1.28 Å

PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a

SCOP Domain Sequences for d1vlba4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlba4 d.133.1.1 (A:311-907) Aldehyde oxidoreductase {Desulfovibrio gigas}
msgpaaaaedaieihpgtpnvyfeqpivkgedtgpifasadvtvegdfyvgrqphmpiep
dvafaymgddgkcyihsksigvhlhlymiapgvglepdqlvlvanpmggtfgykfsptse
alvavaamatgrpvhlrynyqqqqqytgkrspwemnvkfaakkdgtllamesdwlvdhgp
ysefgdlltlrgaqfigagynipnirglgrtvatnhvwgsafrgygapqsmfaseclmdm
laeklgmdplelryknayrpgdtnptgqepevfslpdmidqlrpkyqaalekaqkestat
hkkgvgisigvygsgldgpdaseawaelnadgtitvhtawedhgqgadigcvgtahealr
pmgvapekikftwpntattpnsgpsggsrqqvmtgnairvacenllkacekpgggyytyd
elkaadkptkitgnwtasgathcdavtglgkpfvvymygvfmaevtvdvatgqttvdgmt
lmadlgslcnqlatdgqiygglaqgiglalsedfedikkhatlvgagfpfikqipdkldi
vyvnhprpdgpfgasgvgelpltsphaaiinaiksatgvriyrlpaypekvlealka

SCOP Domain Coordinates for d1vlba4:

Click to download the PDB-style file with coordinates for d1vlba4.
(The format of our PDB-style files is described here.)

Timeline for d1vlba4: