Lineage for d1vlba3 (1vlb A:194-310)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502780Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 502781Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 502782Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (5 proteins)
  6. 502783Protein Aldehyde oxidoreductase, domain 3 [54667] (2 species)
  7. 502786Species Desulfovibrio gigas [TaxId:879] [54668] (2 PDB entries)
  8. 502787Domain d1vlba3: 1vlb A:194-310 [108741]
    Other proteins in same PDB: d1vlba1, d1vlba2, d1vlba4

Details for d1vlba3

PDB Entry: 1vlb (more details), 1.28 Å

PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a

SCOP Domain Sequences for d1vlba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlba3 d.41.1.1 (A:194-310) Aldehyde oxidoreductase, domain 3 {Desulfovibrio gigas}
dygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvithkdvkgknritg
litfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekvkvdleelpay

SCOP Domain Coordinates for d1vlba3:

Click to download the PDB-style file with coordinates for d1vlba3.
(The format of our PDB-style files is described here.)

Timeline for d1vlba3: