Lineage for d1vlba2 (1vlb A:1-80)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598835Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 598929Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (12 proteins)
  6. 598936Protein Aldehyde oxidoreductase, N-terminal domain [54315] (2 species)
  7. 598939Species Desulfovibrio gigas [TaxId:879] [54316] (2 PDB entries)
  8. 598940Domain d1vlba2: 1vlb A:1-80 [108740]
    Other proteins in same PDB: d1vlba1, d1vlba3, d1vlba4
    complexed with cl, fes, ipa, mg, pcd

Details for d1vlba2

PDB Entry: 1vlb (more details), 1.28 Å

PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a

SCOP Domain Sequences for d1vlba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas}
miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
vtkmkrvadgaqittiegvg

SCOP Domain Coordinates for d1vlba2:

Click to download the PDB-style file with coordinates for d1vlba2.
(The format of our PDB-style files is described here.)

Timeline for d1vlba2: