Lineage for d1vlba2 (1vlb A:1-80)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2933995Protein Aldehyde oxidoreductase, N-terminal domain [54315] (2 species)
  7. 2933998Species Desulfovibrio gigas [TaxId:879] [54316] (12 PDB entries)
    Uniprot Q46509
  8. 2933999Domain d1vlba2: 1vlb A:1-80 [108740]
    Other proteins in same PDB: d1vlba1, d1vlba3, d1vlba4
    complexed with cl, fes, ipa, mg, pcd

Details for d1vlba2

PDB Entry: 1vlb (more details), 1.28 Å

PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d1vlba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]}
miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
vtkmkrvadgaqittiegvg

SCOPe Domain Coordinates for d1vlba2:

Click to download the PDB-style file with coordinates for d1vlba2.
(The format of our PDB-style files is described here.)

Timeline for d1vlba2: