SCOPe 2.06: Domain d1vlba1: 1vlb A:81-193

Lineage for d1vlba1 (1vlb A:81-193)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)

6. Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)

7. Species Desulfovibrio gigas [TaxId:879] [47744] (12 PDB entries)
   Uniprot Q46509

8. Domain d1vlba1: 1vlb A:81-193 [108739]
   Other proteins in same PDB: d1vlba2, d1vlba3, d1vlba4
   complexed with cl, fes, ipa, mg, pcd

Details for d1vlba1

PDB Entry: 1vlb, 1.28 Å

PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a

PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d1vlba1:

Sequence; same for both SEQRES and ATOM records:

>d1vlba1 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

Timeline for d1vlba1:

• d1vlba1 first appeared in SCOP 1.69
  
• d1vlba1 appears in SCOPe 2.05
  
• d1vlba1 appears in SCOPe 2.07
  
• d1vlba1 appears in the current release, SCOPe 2.08