Lineage for d1vlba1 (1vlb A:81-193)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539215Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 539216Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 539217Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins)
  6. 539224Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)
  7. 539227Species Desulfovibrio gigas [TaxId:879] [47744] (2 PDB entries)
  8. 539228Domain d1vlba1: 1vlb A:81-193 [108739]
    Other proteins in same PDB: d1vlba2, d1vlba3, d1vlba4
    complexed with cl, fes, ipa, mg, pcd

Details for d1vlba1

PDB Entry: 1vlb (more details), 1.28 Å

PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a

SCOP Domain Sequences for d1vlba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlba1 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

SCOP Domain Coordinates for d1vlba1:

Click to download the PDB-style file with coordinates for d1vlba1.
(The format of our PDB-style files is described here.)

Timeline for d1vlba1: