SCOPe 2.07: Domain d1vlad_: 1vla D:

Lineage for d1vlad_ (1vla D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.227: OsmC-like [82783] (1 superfamily)
   swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix

4. Superfamily d.227.1: OsmC-like [82784] (3 families)

5. Family d.227.1.2: YhfA-like [90027] (2 proteins)

6. Protein Hypothetical protein TM0919 [111184] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [111185] (1 PDB entry)
   Uniprot Q9X021

8. Domain d1vlad_: 1vla D: [108738]
   Other proteins in same PDB: d1vlaa2, d1vlab2, d1vlac2
   Structural genomics target

Details for d1vlad_

PDB Entry: 1vla, 1.8 Å

PDB Description: Crystal structure of Hydroperoxide resistance protein OsmC (TM0919) from Thermotoga maritima at 1.80 A resolution

PDB Compounds: (D:) Hydroperoxide resistance protein OsmC

SCOPe Domain Sequences for d1vlad_:

Sequence; same for both SEQRES and ATOM records:

>d1vlad_ d.227.1.2 (D:) Hypothetical protein TM0919 {Thermotoga maritima [TaxId: 2336]}
mqarwignmmfhvrtdsnhdvlmdtkeevggkdaaprplelvltglmgctgmdvvsilrk
mkvidqmkdfrieieyerteehpriftkvhlkyifkfdgeppkdkvekavqlsqekycsv
sailkcsskvtyeivye

Timeline for d1vlad_:

• d1vlad_ first appeared in SCOP 1.69
  
• d1vlad_ appears in SCOPe 2.06
  
• d1vlad_ appears in the current release, SCOPe 2.08