Lineage for d1vlad_ (1vla D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1945598Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 1945599Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 1945659Family d.227.1.2: YhfA-like [90027] (2 proteins)
  6. 1945663Protein Hypothetical protein TM0919 [111184] (1 species)
  7. 1945664Species Thermotoga maritima [TaxId:2336] [111185] (1 PDB entry)
    Uniprot Q9X021
  8. 1945668Domain d1vlad_: 1vla D: [108738]
    Structural genomics target

Details for d1vlad_

PDB Entry: 1vla (more details), 1.8 Å

PDB Description: Crystal structure of Hydroperoxide resistance protein OsmC (TM0919) from Thermotoga maritima at 1.80 A resolution
PDB Compounds: (D:) Hydroperoxide resistance protein OsmC

SCOPe Domain Sequences for d1vlad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlad_ d.227.1.2 (D:) Hypothetical protein TM0919 {Thermotoga maritima [TaxId: 2336]}
mqarwignmmfhvrtdsnhdvlmdtkeevggkdaaprplelvltglmgctgmdvvsilrk
mkvidqmkdfrieieyerteehpriftkvhlkyifkfdgeppkdkvekavqlsqekycsv
sailkcsskvtyeivye

SCOPe Domain Coordinates for d1vlad_:

Click to download the PDB-style file with coordinates for d1vlad_.
(The format of our PDB-style files is described here.)

Timeline for d1vlad_: