![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
![]() | Superfamily d.227.1: OsmC-like [82784] (3 families) ![]() |
![]() | Family d.227.1.2: YhfA-like [90027] (2 proteins) |
![]() | Protein Hypothetical protein TM0919 [111184] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [111185] (1 PDB entry) Uniprot Q9X021 |
![]() | Domain d1vlac1: 1vla C:1-138 [108737] Other proteins in same PDB: d1vlaa2, d1vlab2, d1vlac2 Structural genomics target |
PDB Entry: 1vla (more details), 1.8 Å
SCOPe Domain Sequences for d1vlac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlac1 d.227.1.2 (C:1-138) Hypothetical protein TM0919 {Thermotoga maritima [TaxId: 2336]} mqarwignmmfhvrtdsnhdvlmdtkeevggkdaaprplelvltglmgctgmdvvsilrk mkvidqmkdfrieieyerteehpriftkvhlkyifkfdgeppkdkvekavqlsqekycsv sailkcsskvtyeivyen
Timeline for d1vlac1: