Lineage for d1vlac1 (1vla C:1-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007845Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 3007846Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 3007915Family d.227.1.2: YhfA-like [90027] (2 proteins)
  6. 3007919Protein Hypothetical protein TM0919 [111184] (1 species)
  7. 3007920Species Thermotoga maritima [TaxId:2336] [111185] (1 PDB entry)
    Uniprot Q9X021
  8. 3007923Domain d1vlac1: 1vla C:1-138 [108737]
    Other proteins in same PDB: d1vlaa2, d1vlab2, d1vlac2
    Structural genomics target

Details for d1vlac1

PDB Entry: 1vla (more details), 1.8 Å

PDB Description: Crystal structure of Hydroperoxide resistance protein OsmC (TM0919) from Thermotoga maritima at 1.80 A resolution
PDB Compounds: (C:) Hydroperoxide resistance protein OsmC

SCOPe Domain Sequences for d1vlac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlac1 d.227.1.2 (C:1-138) Hypothetical protein TM0919 {Thermotoga maritima [TaxId: 2336]}
mqarwignmmfhvrtdsnhdvlmdtkeevggkdaaprplelvltglmgctgmdvvsilrk
mkvidqmkdfrieieyerteehpriftkvhlkyifkfdgeppkdkvekavqlsqekycsv
sailkcsskvtyeivyen

SCOPe Domain Coordinates for d1vlac1:

Click to download the PDB-style file with coordinates for d1vlac1.
(The format of our PDB-style files is described here.)

Timeline for d1vlac1: