Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Gluconate 5-dehydrogenase [110411] (1 species) |
Species Thermotoga maritima [TaxId:2336] [110412] (1 PDB entry) Uniprot Q9WYS2 |
Domain d1vl8b_: 1vl8 B: [108734] Structural genomics target complexed with mg, nap, po4 |
PDB Entry: 1vl8 (more details), 2.07 Å
SCOPe Domain Sequences for d1vl8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vl8b_ c.2.1.2 (B:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} vfdlrgrvalvtggsrglgfgiaqglaeagcsvvvasrnleeaseaaqkltekygvetma frcdvsnyeevkklleavkekfgkldtvvnaaginrrhpaeefpldefrqvievnlfgty yvcreafsllresdnpsiinigsltveevtmpnisayaaskggvasltkalakewgrygi rvnviapgwyrtkmteavfsdpekldymlkriplgrtgvpedlkgvavflaseeakyvtg qiifvdggwtan
Timeline for d1vl8b_: