Lineage for d1vl8b_ (1vl8 B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820348Protein Gluconate 5-dehydrogenase [110411] (1 species)
  7. 820349Species Thermotoga maritima [TaxId:2336] [110412] (1 PDB entry)
    Uniprot Q9WYS2
  8. 820351Domain d1vl8b_: 1vl8 B: [108734]
    Structural genomics target
    complexed with mg, nap, po4

Details for d1vl8b_

PDB Entry: 1vl8 (more details), 2.07 Å

PDB Description: Crystal structure of Gluconate 5-dehydrogenase (TM0441) from Thermotoga maritima at 2.07 A resolution
PDB Compounds: (B:) Gluconate 5-dehydrogenase

SCOP Domain Sequences for d1vl8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vl8b_ c.2.1.2 (B:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]}
vfdlrgrvalvtggsrglgfgiaqglaeagcsvvvasrnleeaseaaqkltekygvetma
frcdvsnyeevkklleavkekfgkldtvvnaaginrrhpaeefpldefrqvievnlfgty
yvcreafsllresdnpsiinigsltveevtmpnisayaaskggvasltkalakewgrygi
rvnviapgwyrtkmteavfsdpekldymlkriplgrtgvpedlkgvavflaseeakyvtg
qiifvdggwtan

SCOP Domain Coordinates for d1vl8b_:

Click to download the PDB-style file with coordinates for d1vl8b_.
(The format of our PDB-style files is described here.)

Timeline for d1vl8b_: