Lineage for d1vl7a_ (1vl7 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464994Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
    barrel; n=6, S=10; greek-key
  4. 464995Superfamily b.45.1: FMN-binding split barrel [50475] (2 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 464996Family b.45.1.1: PNP-oxidase like [50476] (3 proteins)
  6. 465002Protein Hypothetical protein Alr5027 [110234] (1 species)
  7. 465003Species Nostoc sp. strain PCC 7120 [110235] (1 PDB entry)
  8. 465004Domain d1vl7a_: 1vl7 A: [108732]
    Structural genomics target

Details for d1vl7a_

PDB Entry: 1vl7 (more details), 1.5 Å

PDB Description: Crystal structure of a putative heme oxygenase (alr5027) from nostoc sp. pcc 7120 at 1.50 A resolution

SCOP Domain Sequences for d1vl7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vl7a_ b.45.1.1 (A:) Hypothetical protein Alr5027 {Nostoc sp. strain PCC 7120}
yagfiqefqsaiistiseqgipngsyapfviddakniyiyvsglavhtknieanplvnvl
fvddeaktnqifarrrlsfdctatlieresqkwnqvvdqfqerfgqiievlrgladfrif
qltpkegrfvigfga

SCOP Domain Coordinates for d1vl7a_:

Click to download the PDB-style file with coordinates for d1vl7a_.
(The format of our PDB-style files is described here.)

Timeline for d1vl7a_: