SCOPe 2.08: Domain d1vl7a_: 1vl7 A:

Lineage for d1vl7a_ (1vl7 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein Hypothetical protein Alr5027 [110234] (1 species)

7. Species Nostoc sp. PCC 7120 [TaxId:103690] [110235] (1 PDB entry)
   Uniprot Q8YMA7

8. Domain d1vl7a_: 1vl7 A: [108732]
   Structural genomics target
   complexed with edo

Details for d1vl7a_

PDB Entry: 1vl7, 1.5 Å

PDB Description: Crystal structure of a putative heme oxygenase (alr5027) from nostoc sp. pcc 7120 at 1.50 A resolution

PDB Compounds: (A:) hypothetical protein alr5027

SCOPe Domain Sequences for d1vl7a_:

Sequence; same for both SEQRES and ATOM records:

>d1vl7a_ b.45.1.1 (A:) Hypothetical protein Alr5027 {Nostoc sp. PCC 7120 [TaxId: 103690]}
yagfiqefqsaiistiseqgipngsyapfviddakniyiyvsglavhtknieanplvnvl
fvddeaktnqifarrrlsfdctatlieresqkwnqvvdqfqerfgqiievlrgladfrif
qltpkegrfvigfga

Timeline for d1vl7a_:

• d1vl7a_ first appeared in SCOP 1.69
  
• d1vl7a_ appears in SCOPe 2.07