SCOP 1.73: Domain d1vl6d2: 1vl6 D:1-154

Lineage for d1vl6d2 (1vl6 D:1-154)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
   Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand

6. Protein Malate oxidoreductase (malic enzyme) [110452] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [110453] (2 PDB entries)

8. Domain d1vl6d2: 1vl6 D:1-154 [108731]
   Other proteins in same PDB: d1vl6a1, d1vl6b1, d1vl6c1, d1vl6d1
   Structural genomics target

Details for d1vl6d2

PDB Entry: 1vl6, 2.61 Å

PDB Description: Crystal structure of NAD-dependent malic enzyme (TM0542) from Thermotoga maritima at 2.61 A resolution

PDB Compounds: (D:) Malate oxidoreductase

SCOP Domain Sequences for d1vl6d2:

Sequence; same for both SEQRES and ATOM records:

>d1vl6d2 c.58.1.3 (D:1-154) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]}
vdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwntv
avvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivksle
psfgginledigapkcfrilqrlseemnipvfhd

Timeline for d1vl6d2:

• d1vl6d2 first appeared in SCOP 1.69
  
• d1vl6d2 appears in SCOP 1.71
  
• d1vl6d2 appears in SCOP 1.75
  
• d1vl6d2 appears in the current release, SCOPe 2.08