Lineage for d1vl6d2 (1vl6 D:1-154)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489479Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 489480Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 489613Family c.58.1.3: Malic enzyme N-domain (Pfam 00390) [53240] (2 proteins)
    this domain is decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand
  6. 489614Protein Malate oxidoreductase (malic enzyme) [110452] (1 species)
  7. 489615Species Thermotoga maritima [TaxId:243274] [110453] (1 PDB entry)
  8. 489619Domain d1vl6d2: 1vl6 D:1-154 [108731]
    Other proteins in same PDB: d1vl6a1, d1vl6b1, d1vl6c1, d1vl6d1
    Structural genomics target

Details for d1vl6d2

PDB Entry: 1vl6 (more details), 2.61 Å

PDB Description: Crystal structure of NAD-dependent malic enzyme (TM0542) from Thermotoga maritima at 2.61 A resolution

SCOP Domain Sequences for d1vl6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vl6d2 c.58.1.3 (D:1-154) Malate oxidoreductase (malic enzyme) {Thermotoga maritima}
vdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwntv
avvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivksle
psfgginledigapkcfrilqrlseemnipvfhd

SCOP Domain Coordinates for d1vl6d2:

Click to download the PDB-style file with coordinates for d1vl6d2.
(The format of our PDB-style files is described here.)

Timeline for d1vl6d2: