Lineage for d1vl6c1 (1vl6 C:155-376)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 478576Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 478685Protein Malate oxidoreductase (malic enzyme) [110434] (1 species)
  7. 478686Species Thermotoga maritima [TaxId:243274] [110435] (1 PDB entry)
  8. 478689Domain d1vl6c1: 1vl6 C:155-376 [108728]
    Other proteins in same PDB: d1vl6a2, d1vl6b2, d1vl6c2, d1vl6d2

Details for d1vl6c1

PDB Entry: 1vl6 (more details), 2.61 Å

PDB Description: Crystal structure of NAD-dependent malic enzyme (TM0542) from Thermotoga maritima at 2.61 A resolution

SCOP Domain Sequences for d1vl6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vl6c1 c.2.1.7 (C:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima}
dqqgtavvvsaaflnalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkg
ilnendpetclneyhleiaritnperlsgdletalegadffigvsrgnilkpewikkmsr
kpvifalanpvpeidpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitk
nmllsaveaiarscepeperiipeafdmkvhlnvytavkgsa

SCOP Domain Coordinates for d1vl6c1:

Click to download the PDB-style file with coordinates for d1vl6c1.
(The format of our PDB-style files is described here.)

Timeline for d1vl6c1: