Lineage for d1vl5c_ (1vl5 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894026Family c.66.1.41: UbiE/COQ5-like [110671] (5 proteins)
    Pfam PF01209
  6. 2894031Protein Hypothetical protein BH2331 [110672] (1 species)
  7. 2894032Species Bacillus halodurans [TaxId:86665] [110673] (1 PDB entry)
    Uniprot Q9KAF6
  8. 2894035Domain d1vl5c_: 1vl5 C: [108722]
    Structural genomics target

Details for d1vl5c_

PDB Entry: 1vl5 (more details), 1.95 Å

PDB Description: crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution
PDB Compounds: (C:) unknown conserved protein BH2331

SCOPe Domain Sequences for d1vl5c_:

Sequence, based on SEQRES records: (download)

>d1vl5c_ c.66.1.41 (C:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]}
gsdlaklmqiaalkgneevldvatggghvanafapfvkkvvafdltedilkvarafiegn
ghqqveyvqgdaeqmpftderfhivtcriaahhfpnpasfvseayrvlkkggqlllvdns
apendafdvfynyvekerdyshhrawkksdwlkmleeagfeleelhcfhktfifedwcdr
mnvttekkqelsdfikskpteyyqkfkivvedgrvysfrgesilmkarkpt

Sequence, based on observed residues (ATOM records): (download)

>d1vl5c_ c.66.1.41 (C:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]}
gsdlaklmqiaalkgneevldvatggghvanafapfvkkvvafdlqveyvqgdaeqmpft
derfhivtcriaahhfpnpasfvseayrvlkkggqlllvdnsapendafdvfynyveker
dyshhrawkksdwlkmleeagfeleelhcfhktfifedwcdrmnvttekkqelsdfiksk
pteyyqkfkivvedgrvysfrgesilmkarkpt

SCOPe Domain Coordinates for d1vl5c_:

Click to download the PDB-style file with coordinates for d1vl5c_.
(The format of our PDB-style files is described here.)

Timeline for d1vl5c_: