Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.41: UbiE/COQ5-like [110671] (5 proteins) Pfam PF01209 |
Protein Hypothetical protein BH2331 [110672] (1 species) |
Species Bacillus halodurans [TaxId:86665] [110673] (1 PDB entry) Uniprot Q9KAF6 |
Domain d1vl5c_: 1vl5 C: [108722] Structural genomics target |
PDB Entry: 1vl5 (more details), 1.95 Å
SCOPe Domain Sequences for d1vl5c_:
Sequence, based on SEQRES records: (download)
>d1vl5c_ c.66.1.41 (C:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} gsdlaklmqiaalkgneevldvatggghvanafapfvkkvvafdltedilkvarafiegn ghqqveyvqgdaeqmpftderfhivtcriaahhfpnpasfvseayrvlkkggqlllvdns apendafdvfynyvekerdyshhrawkksdwlkmleeagfeleelhcfhktfifedwcdr mnvttekkqelsdfikskpteyyqkfkivvedgrvysfrgesilmkarkpt
>d1vl5c_ c.66.1.41 (C:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} gsdlaklmqiaalkgneevldvatggghvanafapfvkkvvafdlqveyvqgdaeqmpft derfhivtcriaahhfpnpasfvseayrvlkkggqlllvdnsapendafdvfynyveker dyshhrawkksdwlkmleeagfeleelhcfhktfifedwcdrmnvttekkqelsdfiksk pteyyqkfkivvedgrvysfrgesilmkarkpt
Timeline for d1vl5c_: