SCOPe 2.06: Domain d1vl5b_: 1vl5 B:

Lineage for d1vl5b_ (1vl5 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.41: UbiE/COQ5-like [110671] (5 proteins)
   Pfam PF01209

6. Protein Hypothetical protein BH2331 [110672] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [110673] (1 PDB entry)
   Uniprot Q9KAF6

8. Domain d1vl5b_: 1vl5 B: [108721]
   Structural genomics target

Details for d1vl5b_

PDB Entry: 1vl5, 1.95 Å

PDB Description: crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution

PDB Compounds: (B:) unknown conserved protein BH2331

SCOPe Domain Sequences for d1vl5b_:

Sequence; same for both SEQRES and ATOM records:

>d1vl5b_ c.66.1.41 (B:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]}
gsdlaklmqiaalkgneevldvatggghvanafapfvkkvvafdltedilkvarafiegn
ghqqveyvqgdaeqmpftderfhivtcriaahhfpnpasfvseayrvlkkggqlllvdns
apendafdvfynyvekerdyshhrawkksdwlkmleeagfeleelhcfhktfifedwcdr
mnvttekkqelsdfikskpteyyqkfkivvedgrvysfrgesilmkarkpt

Timeline for d1vl5b_:

• d1vl5b_ first appeared in SCOP 1.69
  
• d1vl5b_ appears in SCOPe 2.05
  
• d1vl5b_ appears in SCOPe 2.07
  
• d1vl5b_ appears in the current release, SCOPe 2.08