Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins) |
Protein Argininosuccinate synthetase, N-terminal domain [69458] (3 species) |
Species Thermotoga maritima [TaxId:243274] [110493] (1 PDB entry) |
Domain d1vl2d1: 1vl2 D:2-169 [108714] Other proteins in same PDB: d1vl2a2, d1vl2b2, d1vl2c2, d1vl2d2 Structural genomics target |
PDB Entry: 1vl2 (more details), 1.65 Å
SCOP Domain Sequences for d1vl2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vl2d1 c.26.2.1 (D:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima} kekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikekalktgaskvyved lrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekegaqyvahgatgkgn dqvrfeltyaalnpnlkvispwkdpeflakfkgrtdlinyamekgipi
Timeline for d1vl2d1: