Lineage for d1vl2c2 (1vl2 C:174-404)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612334Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 2612335Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 2612336Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (2 proteins)
  6. 2612337Protein Argininosuccinate synthetase, C-terminal domain [69866] (3 species)
  7. 2612343Species Thermotoga maritima [TaxId:2336] [111276] (1 PDB entry)
    Uniprot Q9X2A1
  8. 2612346Domain d1vl2c2: 1vl2 C:174-404 [108713]
    Other proteins in same PDB: d1vl2a1, d1vl2b1, d1vl2c1, d1vl2d1
    Structural genomics target

Details for d1vl2c2

PDB Entry: 1vl2 (more details), 1.65 Å

PDB Description: crystal structure of argininosuccinate synthase (tm1780) from thermotoga maritima at 1.65 a resolution
PDB Compounds: (C:) argininosuccinate synthase

SCOPe Domain Sequences for d1vl2c2:

Sequence, based on SEQRES records: (download)

>d1vl2c2 d.210.1.1 (C:174-404) Argininosuccinate synthetase, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
krpysedenlmhisheagkledpahipdedvftwtvspkdapdeetlleihfengipvkv
vnlkdgtektdplelfeylnevgakngvgrldmvenrfigiksrgvyetpgatilwiahr
dlegitmdkevmhlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgkvtvsiyk
gnvmpvaryspyslynpelssmdveggfdatdskgfinihalrlkvhqlvk

Sequence, based on observed residues (ATOM records): (download)

>d1vl2c2 d.210.1.1 (C:174-404) Argininosuccinate synthetase, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
krpysedenlmhisheagkledpahipdedvftwtvspkdapdeetlleihfengipvkv
vnlkdgtektdplelfeylnevgakngvgrldmvenrfigiksrgvyetpgatilwiahr
dlegitmdkevmhlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgkvtvsiyk
gnvmpvaryspyslynpggfdatdskgfinihalrlkvhqlvk

SCOPe Domain Coordinates for d1vl2c2:

Click to download the PDB-style file with coordinates for d1vl2c2.
(The format of our PDB-style files is described here.)

Timeline for d1vl2c2: