Lineage for d1vl2c1 (1vl2 C:2-169)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2469527Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2469528Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2469529Protein Argininosuccinate synthetase, N-terminal domain [69458] (3 species)
  7. 2469535Species Thermotoga maritima [TaxId:2336] [110493] (1 PDB entry)
    Uniprot Q9X2A1
  8. 2469538Domain d1vl2c1: 1vl2 C:2-169 [108712]
    Other proteins in same PDB: d1vl2a2, d1vl2b2, d1vl2c2, d1vl2d2
    Structural genomics target

Details for d1vl2c1

PDB Entry: 1vl2 (more details), 1.65 Å

PDB Description: crystal structure of argininosuccinate synthase (tm1780) from thermotoga maritima at 1.65 a resolution
PDB Compounds: (C:) argininosuccinate synthase

SCOPe Domain Sequences for d1vl2c1:

Sequence, based on SEQRES records: (download)

>d1vl2c1 c.26.2.1 (C:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
kekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikekalktgaskvyved
lrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekegaqyvahgatgkgn
dqvrfeltyaalnpnlkvispwkdpeflakfkgrtdlinyamekgipi

Sequence, based on observed residues (ATOM records): (download)

>d1vl2c1 c.26.2.1 (C:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
kekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikekalktgaskvyved
lrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekegaqyvahgatgkgn
dqvrfeltyaalnpnlkvispwkdpeflakfktdlinyamekgipi

SCOPe Domain Coordinates for d1vl2c1:

Click to download the PDB-style file with coordinates for d1vl2c1.
(The format of our PDB-style files is described here.)

Timeline for d1vl2c1: