Lineage for d1vl2c1 (1vl2 C:2-169)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482378Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 482696Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 482697Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins)
  6. 482698Protein Argininosuccinate synthetase, N-terminal domain [69458] (3 species)
  7. 482704Species Thermotoga maritima [TaxId:243274] [110493] (1 PDB entry)
  8. 482707Domain d1vl2c1: 1vl2 C:2-169 [108712]
    Other proteins in same PDB: d1vl2a2, d1vl2b2, d1vl2c2, d1vl2d2

Details for d1vl2c1

PDB Entry: 1vl2 (more details), 1.65 Å

PDB Description: crystal structure of argininosuccinate synthase (tm1780) from thermotoga maritima at 1.65 a resolution

SCOP Domain Sequences for d1vl2c1:

Sequence, based on SEQRES records: (download)

>d1vl2c1 c.26.2.1 (C:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima}
kekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikekalktgaskvyved
lrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekegaqyvahgatgkgn
dqvrfeltyaalnpnlkvispwkdpeflakfkgrtdlinyamekgipi

Sequence, based on observed residues (ATOM records): (download)

>d1vl2c1 c.26.2.1 (C:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima}
kekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikekalktgaskvyved
lrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekegaqyvahgatgkgn
dqvrfeltyaalnpnlkvispwkdpeflakfktdlinyamekgipi

SCOP Domain Coordinates for d1vl2c1:

Click to download the PDB-style file with coordinates for d1vl2c1.
(The format of our PDB-style files is described here.)

Timeline for d1vl2c1: