SCOPe 2.08: Domain d1vl2c1: 1vl2 C:2-169

Lineage for d1vl2c1 (1vl2 C:2-169)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein Argininosuccinate synthetase, N-terminal domain [69458] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [110493] (1 PDB entry)
   Uniprot Q9X2A1

8. Domain d1vl2c1: 1vl2 C:2-169 [108712]
   Other proteins in same PDB: d1vl2a2, d1vl2b2, d1vl2c2, d1vl2d2
   Structural genomics target

Details for d1vl2c1

PDB Entry: 1vl2, 1.65 Å

PDB Description: crystal structure of argininosuccinate synthase (tm1780) from thermotoga maritima at 1.65 a resolution

PDB Compounds: (C:) argininosuccinate synthase

SCOPe Domain Sequences for d1vl2c1:

Sequence, based on SEQRES records:

>d1vl2c1 c.26.2.1 (C:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
kekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikekalktgaskvyved
lrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekegaqyvahgatgkgn
dqvrfeltyaalnpnlkvispwkdpeflakfkgrtdlinyamekgipi

Sequence, based on observed residues (ATOM records):

>d1vl2c1 c.26.2.1 (C:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
kekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikekalktgaskvyved
lrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekegaqyvahgatgkgn
dqvrfeltyaalnpnlkvispwkdpeflakfktdlinyamekgipi

Timeline for d1vl2c1:

• d1vl2c1 first appeared in SCOP 1.69
  
• d1vl2c1 appears in SCOPe 2.07