Lineage for d1vl2b2 (1vl2 B:174-409)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944424Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 1944425Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 1944426Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (1 protein)
  6. 1944427Protein Argininosuccinate synthetase, C-terminal domain [69866] (3 species)
  7. 1944433Species Thermotoga maritima [TaxId:2336] [111276] (1 PDB entry)
    Uniprot Q9X2A1
  8. 1944435Domain d1vl2b2: 1vl2 B:174-409 [108711]
    Other proteins in same PDB: d1vl2a1, d1vl2b1, d1vl2c1, d1vl2d1
    Structural genomics target

Details for d1vl2b2

PDB Entry: 1vl2 (more details), 1.65 Å

PDB Description: crystal structure of argininosuccinate synthase (tm1780) from thermotoga maritima at 1.65 a resolution
PDB Compounds: (B:) argininosuccinate synthase

SCOPe Domain Sequences for d1vl2b2:

Sequence, based on SEQRES records: (download)

>d1vl2b2 d.210.1.1 (B:174-409) Argininosuccinate synthetase, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
krpysedenlmhisheagkledpahipdedvftwtvspkdapdeetlleihfengipvkv
vnlkdgtektdplelfeylnevgakngvgrldmvenrfigiksrgvyetpgatilwiahr
dlegitmdkevmhlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgkvtvsiyk
gnvmpvaryspyslynpelssmdveggfdatdskgfinihalrlkvhqlvkkgyqr

Sequence, based on observed residues (ATOM records): (download)

>d1vl2b2 d.210.1.1 (B:174-409) Argininosuccinate synthetase, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
krpysedenlmhisheagkledpahipdedvftwtvspkdapdeetlleihfengipvkv
vnlkdgtektdplelfeylnevgakngvgrldmvenrfigiksrgvyetpgatilwiahr
dlegitmdkevmhlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgkvtvsiyk
gnvmpvaryspyslyngfdatdskgfinihalrlkvhqlvkkgyqr

SCOPe Domain Coordinates for d1vl2b2:

Click to download the PDB-style file with coordinates for d1vl2b2.
(The format of our PDB-style files is described here.)

Timeline for d1vl2b2: